diff --git a/includes/ado-whidbey-long-md.md b/includes/ado-whidbey-long-md.md
deleted file mode 100644
index 84e4a3f81cb..00000000000
--- a/includes/ado-whidbey-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ADO.NET 2.0
\ No newline at end of file
diff --git a/includes/adonet-edm-md.md b/includes/adonet-edm-md.md
deleted file mode 100644
index 9671f3d5827..00000000000
--- a/includes/adonet-edm-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Entity Data Model
\ No newline at end of file
diff --git a/includes/adonet-ef-md.md b/includes/adonet-ef-md.md
deleted file mode 100644
index 5153cabe4fa..00000000000
--- a/includes/adonet-ef-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Entity Framework
\ No newline at end of file
diff --git a/includes/ajax-current-short-md.md b/includes/ajax-current-short-md.md
deleted file mode 100644
index 1f2bba75f75..00000000000
--- a/includes/ajax-current-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Ajax
\ No newline at end of file
diff --git a/includes/compact-md.md b/includes/compact-md.md
deleted file mode 100644
index f09d3f50950..00000000000
--- a/includes/compact-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Compact Framework
\ No newline at end of file
diff --git a/includes/cpp-iter-arg-md.md b/includes/cpp-iter-arg-md.md
deleted file mode 100644
index e6f7748d475..00000000000
--- a/includes/cpp-iter-arg-md.md
+++ /dev/null
@@ -1 +0,0 @@
-The type of an element in the controlled sequence.
\ No newline at end of file
diff --git a/includes/csprcslong-md.md b/includes/csprcslong-md.md
deleted file mode 100644
index 0190f9c8971..00000000000
--- a/includes/csprcslong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual C# 2005
\ No newline at end of file
diff --git a/includes/desktop-appname-md.md b/includes/desktop-appname-md.md
deleted file mode 100644
index 8714ca25df6..00000000000
--- a/includes/desktop-appname-md.md
+++ /dev/null
@@ -1 +0,0 @@
-desktop
\ No newline at end of file
diff --git a/includes/dnprdnext-md.md b/includes/dnprdnext-md.md
deleted file mode 100644
index a85e933d2f6..00000000000
--- a/includes/dnprdnext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 2.0
\ No newline at end of file
diff --git a/includes/dnprdnlong-md.md b/includes/dnprdnlong-md.md
deleted file mode 100644
index a85e933d2f6..00000000000
--- a/includes/dnprdnlong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 2.0
\ No newline at end of file
diff --git a/includes/dnprdnshort-md.md b/includes/dnprdnshort-md.md
deleted file mode 100644
index 578b265eda1..00000000000
--- a/includes/dnprdnshort-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework
\ No newline at end of file
diff --git a/includes/dp-id-field-label-md.md b/includes/dp-id-field-label-md.md
deleted file mode 100644
index 543d051fb3a..00000000000
--- a/includes/dp-id-field-label-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Dependency property identifier field:
\ No newline at end of file
diff --git a/includes/esql-md.md b/includes/esql-md.md
deleted file mode 100644
index 454e7fd1848..00000000000
--- a/includes/esql-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Entity SQL
\ No newline at end of file
diff --git a/includes/iisver-md.md b/includes/iisver-md.md
deleted file mode 100644
index 67f5b1fa851..00000000000
--- a/includes/iisver-md.md
+++ /dev/null
@@ -1 +0,0 @@
-IIS 7.0
\ No newline at end of file
diff --git a/includes/infocard-md.md b/includes/infocard-md.md
deleted file mode 100644
index 4c1f24ace17..00000000000
--- a/includes/infocard-md.md
+++ /dev/null
@@ -1 +0,0 @@
-CardSpace
\ No newline at end of file
diff --git a/includes/linq-dataset-md.md b/includes/linq-dataset-md.md
deleted file mode 100644
index 7cb495733db..00000000000
--- a/includes/linq-dataset-md.md
+++ /dev/null
@@ -1 +0,0 @@
-LINQ to DataSet
\ No newline at end of file
diff --git a/includes/ndptecclick-md.md b/includes/ndptecclick-md.md
deleted file mode 100644
index 9354b8371a8..00000000000
--- a/includes/ndptecclick-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ClickOnce
\ No newline at end of file
diff --git a/includes/ndptecgdi-md.md b/includes/ndptecgdi-md.md
deleted file mode 100644
index dca1dfd7aac..00000000000
--- a/includes/ndptecgdi-md.md
+++ /dev/null
@@ -1 +0,0 @@
-GDI
\ No newline at end of file
diff --git a/includes/ndptecgdiplus-md.md b/includes/ndptecgdiplus-md.md
deleted file mode 100644
index 5b0edbf8453..00000000000
--- a/includes/ndptecgdiplus-md.md
+++ /dev/null
@@ -1 +0,0 @@
-GDI+
\ No newline at end of file
diff --git a/includes/net-client-v40-long-md.md b/includes/net-client-v40-long-md.md
deleted file mode 100644
index 6eb2fced46b..00000000000
--- a/includes/net-client-v40-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4 Client Profile
\ No newline at end of file
diff --git a/includes/net-core-md.md b/includes/net-core-md.md
deleted file mode 100644
index f53daf1278b..00000000000
--- a/includes/net-core-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Core
\ No newline at end of file
diff --git a/includes/net-native-md.md b/includes/net-native-md.md
deleted file mode 100644
index e4b04f97331..00000000000
--- a/includes/net-native-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Native
\ No newline at end of file
diff --git a/includes/net-portable-md.md b/includes/net-portable-md.md
deleted file mode 100644
index 27b84cba069..00000000000
--- a/includes/net-portable-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Portable Class Library
\ No newline at end of file
diff --git a/includes/net-v10-short-md.md b/includes/net-v10-short-md.md
deleted file mode 100644
index 2fa845562a3..00000000000
--- a/includes/net-v10-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 1.0
\ No newline at end of file
diff --git a/includes/net-v11-long-md.md b/includes/net-v11-long-md.md
deleted file mode 100644
index cee1774a1ff..00000000000
--- a/includes/net-v11-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 1.1
\ No newline at end of file
diff --git a/includes/net-v11-short-md.md b/includes/net-v11-short-md.md
deleted file mode 100644
index cee1774a1ff..00000000000
--- a/includes/net-v11-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 1.1
\ No newline at end of file
diff --git a/includes/net-v20sp1-long-md.md b/includes/net-v20sp1-long-md.md
deleted file mode 100644
index 8c0ce41f6b4..00000000000
--- a/includes/net-v20sp1-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 2.0 Service Pack 1
\ No newline at end of file
diff --git a/includes/net-v20sp1-short-md.md b/includes/net-v20sp1-short-md.md
deleted file mode 100644
index 9cf1b8e62db..00000000000
--- a/includes/net-v20sp1-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 2.0 SP1
\ No newline at end of file
diff --git a/includes/net-v30-long-md.md b/includes/net-v30-long-md.md
deleted file mode 100644
index 8ed710fd7bf..00000000000
--- a/includes/net-v30-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.0
\ No newline at end of file
diff --git a/includes/net-v30-short-md.md b/includes/net-v30-short-md.md
deleted file mode 100644
index 8ed710fd7bf..00000000000
--- a/includes/net-v30-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.0
\ No newline at end of file
diff --git a/includes/net-v35-long-md.md b/includes/net-v35-long-md.md
deleted file mode 100644
index 8c423191688..00000000000
--- a/includes/net-v35-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
- .NET Framework 3.5
diff --git a/includes/net-v35-short-md.md b/includes/net-v35-short-md.md
deleted file mode 100644
index 3b3e17628c7..00000000000
--- a/includes/net-v35-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.5
\ No newline at end of file
diff --git a/includes/net-v35sp1-long-md.md b/includes/net-v35sp1-long-md.md
deleted file mode 100644
index a4bbf5adf40..00000000000
--- a/includes/net-v35sp1-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.5 Service Pack 1
\ No newline at end of file
diff --git a/includes/net-v35sp1-short-md.md b/includes/net-v35sp1-short-md.md
deleted file mode 100644
index 0f46ca34db3..00000000000
--- a/includes/net-v35sp1-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.5 SP1
\ No newline at end of file
diff --git a/includes/net-v40-long-md.md b/includes/net-v40-long-md.md
deleted file mode 100644
index a6ccdbf9fb7..00000000000
--- a/includes/net-v40-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4
\ No newline at end of file
diff --git a/includes/net-v40-short-md.md b/includes/net-v40-short-md.md
deleted file mode 100644
index a6ccdbf9fb7..00000000000
--- a/includes/net-v40-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4
\ No newline at end of file
diff --git a/includes/net-v45-md.md b/includes/net-v45-md.md
deleted file mode 100644
index 7b4bf0fb0dc..00000000000
--- a/includes/net-v45-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.5
\ No newline at end of file
diff --git a/includes/net-v451-md.md b/includes/net-v451-md.md
deleted file mode 100644
index 81ec8b4536e..00000000000
--- a/includes/net-v451-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.5.1
\ No newline at end of file
diff --git a/includes/net-v452-md.md b/includes/net-v452-md.md
deleted file mode 100644
index 5db8902ca2f..00000000000
--- a/includes/net-v452-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.5.2
\ No newline at end of file
diff --git a/includes/net-v46-md.md b/includes/net-v46-md.md
deleted file mode 100644
index f091db4a79c..00000000000
--- a/includes/net-v46-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.6
\ No newline at end of file
diff --git a/includes/net-v461-md.md b/includes/net-v461-md.md
deleted file mode 100644
index f12ccd97aa6..00000000000
--- a/includes/net-v461-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.6.1
\ No newline at end of file
diff --git a/includes/net-v462-md.md b/includes/net-v462-md.md
deleted file mode 100644
index 5386eb0cfae..00000000000
--- a/includes/net-v462-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.6.2
\ No newline at end of file
diff --git a/includes/net-v463-md.md b/includes/net-v463-md.md
deleted file mode 100644
index 1d73e3cdcca..00000000000
--- a/includes/net-v463-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4.7
\ No newline at end of file
diff --git a/includes/net-win8-profile-md.md b/includes/net-win8-profile-md.md
deleted file mode 100644
index 4a9dc2f8dcf..00000000000
--- a/includes/net-win8-profile-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET for Windows 8.x Store apps
\ No newline at end of file
diff --git a/includes/netfx35-long-md.md b/includes/netfx35-long-md.md
deleted file mode 100644
index 137eaf9672c..00000000000
--- a/includes/netfx35-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework version 3.5
\ No newline at end of file
diff --git a/includes/netfx35-short-md.md b/includes/netfx35-short-md.md
deleted file mode 100644
index 3b3e17628c7..00000000000
--- a/includes/netfx35-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 3.5
\ No newline at end of file
diff --git a/includes/netfx40-long-md.md b/includes/netfx40-long-md.md
deleted file mode 100644
index 159059ada1c..00000000000
--- a/includes/netfx40-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework version 4
\ No newline at end of file
diff --git a/includes/netfx40-short-md.md b/includes/netfx40-short-md.md
deleted file mode 100644
index a6ccdbf9fb7..00000000000
--- a/includes/netfx40-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework 4
\ No newline at end of file
diff --git a/includes/ofprword-md.md b/includes/ofprword-md.md
deleted file mode 100644
index 4c0765a254f..00000000000
--- a/includes/ofprword-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Word
\ No newline at end of file
diff --git a/includes/sil3-first-md.md b/includes/sil3-first-md.md
deleted file mode 100644
index 5734e289b38..00000000000
--- a/includes/sil3-first-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Silverlight 3
\ No newline at end of file
diff --git a/includes/silverlight-md.md b/includes/silverlight-md.md
deleted file mode 100644
index df62f960fed..00000000000
--- a/includes/silverlight-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Silverlight
\ No newline at end of file
diff --git a/includes/sqltecxlinq-md.md b/includes/sqltecxlinq-md.md
deleted file mode 100644
index 2034e69937a..00000000000
--- a/includes/sqltecxlinq-md.md
+++ /dev/null
@@ -1 +0,0 @@
-LINQ to XML
\ No newline at end of file
diff --git a/includes/sqprsqlong-md.md b/includes/sqprsqlong-md.md
deleted file mode 100644
index f2d5b72816d..00000000000
--- a/includes/sqprsqlong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-SQL Server 2005
\ No newline at end of file
diff --git a/includes/ss2k-md.md b/includes/ss2k-md.md
deleted file mode 100644
index 3fe9a5c1949..00000000000
--- a/includes/ss2k-md.md
+++ /dev/null
@@ -1 +0,0 @@
-SQL Server 2000
\ No newline at end of file
diff --git a/includes/ssastoria-md.md b/includes/ssastoria-md.md
deleted file mode 100644
index 7ccf532a05d..00000000000
--- a/includes/ssastoria-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WCF Data Services
\ No newline at end of file
diff --git a/includes/ssew-md.md b/includes/ssew-md.md
deleted file mode 100644
index d3ab3d9099e..00000000000
--- a/includes/ssew-md.md
+++ /dev/null
@@ -1 +0,0 @@
-SQL Server Compact 3.5
\ No newline at end of file
diff --git a/includes/sskatmai-r2-md.md b/includes/sskatmai-r2-md.md
deleted file mode 100644
index 16f111e6b9c..00000000000
--- a/includes/sskatmai-r2-md.md
+++ /dev/null
@@ -1 +0,0 @@
-SQL Server 2008 R2
\ No newline at end of file
diff --git a/includes/ssodatashort-md.md b/includes/ssodatashort-md.md
deleted file mode 100644
index 52fc7f5729f..00000000000
--- a/includes/ssodatashort-md.md
+++ /dev/null
@@ -1 +0,0 @@
-OData
\ No newline at end of file
diff --git a/includes/tla2sharptla-2d-md.md b/includes/tla2sharptla-2d-md.md
deleted file mode 100644
index 23190149962..00000000000
--- a/includes/tla2sharptla-2d-md.md
+++ /dev/null
@@ -1 +0,0 @@
-2-D
\ No newline at end of file
diff --git a/includes/tla2sharptla-3d-md.md b/includes/tla2sharptla-3d-md.md
deleted file mode 100644
index a8b112e9f71..00000000000
--- a/includes/tla2sharptla-3d-md.md
+++ /dev/null
@@ -1 +0,0 @@
-3-D
\ No newline at end of file
diff --git a/includes/tla2sharptla-baml-md.md b/includes/tla2sharptla-baml-md.md
deleted file mode 100644
index e45e928c49a..00000000000
--- a/includes/tla2sharptla-baml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-BAML
\ No newline at end of file
diff --git a/includes/tla2sharptla-bpp-md.md b/includes/tla2sharptla-bpp-md.md
deleted file mode 100644
index 315a6682a8a..00000000000
--- a/includes/tla2sharptla-bpp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-BPP
\ No newline at end of file
diff --git a/includes/tla2sharptla-caf-md.md b/includes/tla2sharptla-caf-md.md
deleted file mode 100644
index cbbf1fee287..00000000000
--- a/includes/tla2sharptla-caf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Annotations Framework
\ No newline at end of file
diff --git a/includes/tla2sharptla-clr-md.md b/includes/tla2sharptla-clr-md.md
deleted file mode 100644
index 24584f2c1f2..00000000000
--- a/includes/tla2sharptla-clr-md.md
+++ /dev/null
@@ -1 +0,0 @@
-CLR
\ No newline at end of file
diff --git a/includes/tla2sharptla-com-md.md b/includes/tla2sharptla-com-md.md
deleted file mode 100644
index 2ce1fe653b3..00000000000
--- a/includes/tla2sharptla-com-md.md
+++ /dev/null
@@ -1 +0,0 @@
-COM
\ No newline at end of file
diff --git a/includes/tla2sharptla-dpi-md.md b/includes/tla2sharptla-dpi-md.md
deleted file mode 100644
index 98a0f7fb82e..00000000000
--- a/includes/tla2sharptla-dpi-md.md
+++ /dev/null
@@ -1 +0,0 @@
-dpi
\ No newline at end of file
diff --git a/includes/tla2sharptla-dx-md.md b/includes/tla2sharptla-dx-md.md
deleted file mode 100644
index 71d221e075a..00000000000
--- a/includes/tla2sharptla-dx-md.md
+++ /dev/null
@@ -1 +0,0 @@
-DirectX
\ No newline at end of file
diff --git a/includes/tla2sharptla-exif-md.md b/includes/tla2sharptla-exif-md.md
deleted file mode 100644
index 3e484bc7a73..00000000000
--- a/includes/tla2sharptla-exif-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Exif
\ No newline at end of file
diff --git a/includes/tla2sharptla-gui-md.md b/includes/tla2sharptla-gui-md.md
deleted file mode 100644
index 70fac1bcb13..00000000000
--- a/includes/tla2sharptla-gui-md.md
+++ /dev/null
@@ -1 +0,0 @@
-GUI
\ No newline at end of file
diff --git a/includes/tla2sharptla-html-md.md b/includes/tla2sharptla-html-md.md
deleted file mode 100644
index 3225efc49a9..00000000000
--- a/includes/tla2sharptla-html-md.md
+++ /dev/null
@@ -1 +0,0 @@
-HTML
\ No newline at end of file
diff --git a/includes/tla2sharptla-idsharpplural-md.md b/includes/tla2sharptla-idsharpplural-md.md
deleted file mode 100644
index 609a8712ba6..00000000000
--- a/includes/tla2sharptla-idsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-IDs
\ No newline at end of file
diff --git a/includes/tla2sharptla-ie6-md.md b/includes/tla2sharptla-ie6-md.md
deleted file mode 100644
index e880d15a013..00000000000
--- a/includes/tla2sharptla-ie6-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Internet Explorer 6
\ No newline at end of file
diff --git a/includes/tla2sharptla-ie7-md.md b/includes/tla2sharptla-ie7-md.md
deleted file mode 100644
index 95495b465f0..00000000000
--- a/includes/tla2sharptla-ie7-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Internet Explorer 7
\ No newline at end of file
diff --git a/includes/tla2sharptla-iegeneric-md.md b/includes/tla2sharptla-iegeneric-md.md
deleted file mode 100644
index 44bb34c8f97..00000000000
--- a/includes/tla2sharptla-iegeneric-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Internet Explorer
\ No newline at end of file
diff --git a/includes/tla2sharptla-mime-md.md b/includes/tla2sharptla-mime-md.md
deleted file mode 100644
index 59664a72a19..00000000000
--- a/includes/tla2sharptla-mime-md.md
+++ /dev/null
@@ -1 +0,0 @@
-MIME
\ No newline at end of file
diff --git a/includes/tla2sharptla-net-md.md b/includes/tla2sharptla-net-md.md
deleted file mode 100644
index d49ef201e75..00000000000
--- a/includes/tla2sharptla-net-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET
\ No newline at end of file
diff --git a/includes/tla2sharptla-netframewkattr-md.md b/includes/tla2sharptla-netframewkattr-md.md
deleted file mode 100644
index ee303926c37..00000000000
--- a/includes/tla2sharptla-netframewkattr-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework attribute
\ No newline at end of file
diff --git a/includes/tla2sharptla-opentype-md.md b/includes/tla2sharptla-opentype-md.md
deleted file mode 100644
index fad0b0bfa09..00000000000
--- a/includes/tla2sharptla-opentype-md.md
+++ /dev/null
@@ -1 +0,0 @@
-OpenType
\ No newline at end of file
diff --git a/includes/tla2sharptla-passport-md.md b/includes/tla2sharptla-passport-md.md
deleted file mode 100644
index 46ca96f199f..00000000000
--- a/includes/tla2sharptla-passport-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Live ID
\ No newline at end of file
diff --git a/includes/tla2sharptla-png-md.md b/includes/tla2sharptla-png-md.md
deleted file mode 100644
index 67461379f1f..00000000000
--- a/includes/tla2sharptla-png-md.md
+++ /dev/null
@@ -1 +0,0 @@
-PNG
\ No newline at end of file
diff --git a/includes/tla2sharptla-riff-md.md b/includes/tla2sharptla-riff-md.md
deleted file mode 100644
index a71100636e8..00000000000
--- a/includes/tla2sharptla-riff-md.md
+++ /dev/null
@@ -1 +0,0 @@
-RIFF
\ No newline at end of file
diff --git a/includes/tla2sharptla-sdk-md.md b/includes/tla2sharptla-sdk-md.md
deleted file mode 100644
index bb3427d9181..00000000000
--- a/includes/tla2sharptla-sdk-md.md
+++ /dev/null
@@ -1 +0,0 @@
-SDK
\ No newline at end of file
diff --git a/includes/tla2sharptla-tiff-md.md b/includes/tla2sharptla-tiff-md.md
deleted file mode 100644
index 915ecc800dd..00000000000
--- a/includes/tla2sharptla-tiff-md.md
+++ /dev/null
@@ -1 +0,0 @@
-TIFF
\ No newline at end of file
diff --git a/includes/tla2sharptla-titlexaml-md.md b/includes/tla2sharptla-titlexaml-md.md
deleted file mode 100644
index 7d3d6afaedc..00000000000
--- a/includes/tla2sharptla-titlexaml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML
\ No newline at end of file
diff --git a/includes/tla2sharptla-tpc-md.md b/includes/tla2sharptla-tpc-md.md
deleted file mode 100644
index 834bcfc55be..00000000000
--- a/includes/tla2sharptla-tpc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Tablet PC
\ No newline at end of file
diff --git a/includes/tla2sharptla-ui-md.md b/includes/tla2sharptla-ui-md.md
deleted file mode 100644
index f599d5c5cad..00000000000
--- a/includes/tla2sharptla-ui-md.md
+++ /dev/null
@@ -1 +0,0 @@
-UI
\ No newline at end of file
diff --git a/includes/tla2sharptla-uiautomation-md.md b/includes/tla2sharptla-uiautomation-md.md
deleted file mode 100644
index c8f4954a9c8..00000000000
--- a/includes/tla2sharptla-uiautomation-md.md
+++ /dev/null
@@ -1 +0,0 @@
-UI Automation
\ No newline at end of file
diff --git a/includes/tla2sharptla-uisharpplural-md.md b/includes/tla2sharptla-uisharpplural-md.md
deleted file mode 100644
index e1a4e2447ab..00000000000
--- a/includes/tla2sharptla-uisharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-UIs
\ No newline at end of file
diff --git a/includes/tla2sharptla-url-md.md b/includes/tla2sharptla-url-md.md
deleted file mode 100644
index e6a755c451b..00000000000
--- a/includes/tla2sharptla-url-md.md
+++ /dev/null
@@ -1 +0,0 @@
-URL
\ No newline at end of file
diff --git a/includes/tla2sharptla-wdp-md.md b/includes/tla2sharptla-wdp-md.md
deleted file mode 100644
index 42498a289c9..00000000000
--- a/includes/tla2sharptla-wdp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Media Photo
\ No newline at end of file
diff --git a/includes/tla2sharptla-win32-md.md b/includes/tla2sharptla-win32-md.md
deleted file mode 100644
index df14f554429..00000000000
--- a/includes/tla2sharptla-win32-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Win32
\ No newline at end of file
diff --git a/includes/tla2sharptla-winclient-md.md b/includes/tla2sharptla-winclient-md.md
deleted file mode 100644
index 92826b01ec3..00000000000
--- a/includes/tla2sharptla-winclient-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WPF
\ No newline at end of file
diff --git a/includes/tla2sharptla-winvista-md.md b/includes/tla2sharptla-winvista-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/tla2sharptla-winvista-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/tla2sharptla-wpf-md.md b/includes/tla2sharptla-wpf-md.md
deleted file mode 100644
index 92826b01ec3..00000000000
--- a/includes/tla2sharptla-wpf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WPF
\ No newline at end of file
diff --git a/includes/tla2sharptla-xaml-md.md b/includes/tla2sharptla-xaml-md.md
deleted file mode 100644
index 7d3d6afaedc..00000000000
--- a/includes/tla2sharptla-xaml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML
\ No newline at end of file
diff --git a/includes/tla2sharptla-xbap-md.md b/includes/tla2sharptla-xbap-md.md
deleted file mode 100644
index 6d0f65efa85..00000000000
--- a/includes/tla2sharptla-xbap-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XBAP
\ No newline at end of file
diff --git a/includes/tla2sharptla-xbapsharpplural-md.md b/includes/tla2sharptla-xbapsharpplural-md.md
deleted file mode 100644
index 63dc7de84d0..00000000000
--- a/includes/tla2sharptla-xbapsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XBAPs
\ No newline at end of file
diff --git a/includes/tla2sharptla-xml-md.md b/includes/tla2sharptla-xml-md.md
deleted file mode 100644
index f86a2f5fe92..00000000000
--- a/includes/tla2sharptla-xml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XML
\ No newline at end of file
diff --git a/includes/tla2sharptla-xps-md.md b/includes/tla2sharptla-xps-md.md
deleted file mode 100644
index bc32e60a990..00000000000
--- a/includes/tla2sharptla-xps-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XPS
\ No newline at end of file
diff --git a/includes/tla2sharptla-xrml-md.md b/includes/tla2sharptla-xrml-md.md
deleted file mode 100644
index cceedef6a85..00000000000
--- a/includes/tla2sharptla-xrml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XrML
\ No newline at end of file
diff --git a/includes/tlasharptla-2d-md.md b/includes/tlasharptla-2d-md.md
deleted file mode 100644
index 23190149962..00000000000
--- a/includes/tlasharptla-2d-md.md
+++ /dev/null
@@ -1 +0,0 @@
-2-D
\ No newline at end of file
diff --git a/includes/tlasharptla-3d-md.md b/includes/tlasharptla-3d-md.md
deleted file mode 100644
index a8b112e9f71..00000000000
--- a/includes/tlasharptla-3d-md.md
+++ /dev/null
@@ -1 +0,0 @@
-3-D
\ No newline at end of file
diff --git a/includes/tlasharptla-aa-md.md b/includes/tlasharptla-aa-md.md
deleted file mode 100644
index 53bf1bc086c..00000000000
--- a/includes/tlasharptla-aa-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Active Accessibility
\ No newline at end of file
diff --git a/includes/tlasharptla-adonet-md.md b/includes/tlasharptla-adonet-md.md
deleted file mode 100644
index 7b6552e6405..00000000000
--- a/includes/tlasharptla-adonet-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ADO.NET
\ No newline at end of file
diff --git a/includes/tlasharptla-aero-md.md b/includes/tlasharptla-aero-md.md
deleted file mode 100644
index 596f97cb2ad..00000000000
--- a/includes/tlasharptla-aero-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Aero
\ No newline at end of file
diff --git a/includes/tlasharptla-argb-md.md b/includes/tlasharptla-argb-md.md
deleted file mode 100644
index 061590f4b45..00000000000
--- a/includes/tlasharptla-argb-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ARGB
\ No newline at end of file
diff --git a/includes/tlasharptla-ascii-md.md b/includes/tlasharptla-ascii-md.md
deleted file mode 100644
index 290822646f5..00000000000
--- a/includes/tlasharptla-ascii-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ASCII
\ No newline at end of file
diff --git a/includes/tlasharptla-baml-md.md b/includes/tlasharptla-baml-md.md
deleted file mode 100644
index d43a4bfd804..00000000000
--- a/includes/tlasharptla-baml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-binary XAML (BAML)
\ No newline at end of file
diff --git a/includes/tlasharptla-bmp-md.md b/includes/tlasharptla-bmp-md.md
deleted file mode 100644
index 1dda1bbd7ae..00000000000
--- a/includes/tlasharptla-bmp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-bitmap (BMP)
\ No newline at end of file
diff --git a/includes/tlasharptla-bpp-md.md b/includes/tlasharptla-bpp-md.md
deleted file mode 100644
index 949f6c8904d..00000000000
--- a/includes/tlasharptla-bpp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-bits per pixel (BPP)
\ No newline at end of file
diff --git a/includes/tlasharptla-caf-md.md b/includes/tlasharptla-caf-md.md
deleted file mode 100644
index 0b4f564eed7..00000000000
--- a/includes/tlasharptla-caf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Annotations Framework
\ No newline at end of file
diff --git a/includes/tlasharptla-cas-md.md b/includes/tlasharptla-cas-md.md
deleted file mode 100644
index 1b55ee4f4bf..00000000000
--- a/includes/tlasharptla-cas-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Code Access Security (CAS)
\ No newline at end of file
diff --git a/includes/tlasharptla-clickonce-md.md b/includes/tlasharptla-clickonce-md.md
deleted file mode 100644
index 9354b8371a8..00000000000
--- a/includes/tlasharptla-clickonce-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ClickOnce
\ No newline at end of file
diff --git a/includes/tlasharptla-clr-md.md b/includes/tlasharptla-clr-md.md
deleted file mode 100644
index aae1d297846..00000000000
--- a/includes/tlasharptla-clr-md.md
+++ /dev/null
@@ -1 +0,0 @@
-common language runtime (CLR)
\ No newline at end of file
diff --git a/includes/tlasharptla-com-md.md b/includes/tlasharptla-com-md.md
deleted file mode 100644
index bcd1d039d93..00000000000
--- a/includes/tlasharptla-com-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Component Object Model (COM)
\ No newline at end of file
diff --git a/includes/tlasharptla-dhtml-md.md b/includes/tlasharptla-dhtml-md.md
deleted file mode 100644
index c049622549b..00000000000
--- a/includes/tlasharptla-dhtml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Dynamic HTML (DHTML)
\ No newline at end of file
diff --git a/includes/tlasharptla-dipixel-md.md b/includes/tlasharptla-dipixel-md.md
deleted file mode 100644
index 853f091f5a9..00000000000
--- a/includes/tlasharptla-dipixel-md.md
+++ /dev/null
@@ -1 +0,0 @@
-device-independent unit (1/96th inch)
\ No newline at end of file
diff --git a/includes/tlasharptla-dipixelsharpplural-md.md b/includes/tlasharptla-dipixelsharpplural-md.md
deleted file mode 100644
index 376eb02a701..00000000000
--- a/includes/tlasharptla-dipixelsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-device-independent units (1/96th inch per unit)
\ No newline at end of file
diff --git a/includes/tlasharptla-dll-md.md b/includes/tlasharptla-dll-md.md
deleted file mode 100644
index 34bf682a547..00000000000
--- a/includes/tlasharptla-dll-md.md
+++ /dev/null
@@ -1 +0,0 @@
-dynamic-link library (DLL)
\ No newline at end of file
diff --git a/includes/tlasharptla-dpi-md.md b/includes/tlasharptla-dpi-md.md
deleted file mode 100644
index b3e2a26117b..00000000000
--- a/includes/tlasharptla-dpi-md.md
+++ /dev/null
@@ -1 +0,0 @@
-dots per inch (dpi)
\ No newline at end of file
diff --git a/includes/tlasharptla-emf-md.md b/includes/tlasharptla-emf-md.md
deleted file mode 100644
index 0a806a65d09..00000000000
--- a/includes/tlasharptla-emf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Enhanced Metafile (EMF)
\ No newline at end of file
diff --git a/includes/tlasharptla-exif-md.md b/includes/tlasharptla-exif-md.md
deleted file mode 100644
index e83b97fa051..00000000000
--- a/includes/tlasharptla-exif-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Exchangeable image file (Exif)
\ No newline at end of file
diff --git a/includes/tlasharptla-gdi-md.md b/includes/tlasharptla-gdi-md.md
deleted file mode 100644
index 76a6f0989db..00000000000
--- a/includes/tlasharptla-gdi-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows Graphics Device Interface (GDI)
\ No newline at end of file
diff --git a/includes/tlasharptla-gif-md.md b/includes/tlasharptla-gif-md.md
deleted file mode 100644
index 37b0d8db92e..00000000000
--- a/includes/tlasharptla-gif-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Graphics Interchange Format (GIF)
\ No newline at end of file
diff --git a/includes/tlasharptla-gui-md.md b/includes/tlasharptla-gui-md.md
deleted file mode 100644
index 1413fa23350..00000000000
--- a/includes/tlasharptla-gui-md.md
+++ /dev/null
@@ -1 +0,0 @@
-graphical user interface (GUI)
\ No newline at end of file
diff --git a/includes/tlasharptla-html-md.md b/includes/tlasharptla-html-md.md
deleted file mode 100644
index 3225efc49a9..00000000000
--- a/includes/tlasharptla-html-md.md
+++ /dev/null
@@ -1 +0,0 @@
-HTML
\ No newline at end of file
diff --git a/includes/tlasharptla-icc-md.md b/includes/tlasharptla-icc-md.md
deleted file mode 100644
index 1b50117c2d8..00000000000
--- a/includes/tlasharptla-icc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-International Color Consortium (ICC)
\ No newline at end of file
diff --git a/includes/tlasharptla-icm-md.md b/includes/tlasharptla-icm-md.md
deleted file mode 100644
index de667e4fcd3..00000000000
--- a/includes/tlasharptla-icm-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Image Color Management (ICM)
\ No newline at end of file
diff --git a/includes/tlasharptla-id-md.md b/includes/tlasharptla-id-md.md
deleted file mode 100644
index e9576e4e1de..00000000000
--- a/includes/tlasharptla-id-md.md
+++ /dev/null
@@ -1 +0,0 @@
-identifier (ID)
\ No newline at end of file
diff --git a/includes/tlasharptla-idsharpplural-md.md b/includes/tlasharptla-idsharpplural-md.md
deleted file mode 100644
index 3fe608f9635..00000000000
--- a/includes/tlasharptla-idsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-identifiers (IDs)
\ No newline at end of file
diff --git a/includes/tlasharptla-ie-md.md b/includes/tlasharptla-ie-md.md
deleted file mode 100644
index a0e6d7ff79e..00000000000
--- a/includes/tlasharptla-ie-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Internet Explorer
\ No newline at end of file
diff --git a/includes/tlasharptla-ie6-md.md b/includes/tlasharptla-ie6-md.md
deleted file mode 100644
index e880d15a013..00000000000
--- a/includes/tlasharptla-ie6-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Internet Explorer 6
\ No newline at end of file
diff --git a/includes/tlasharptla-ie7-md.md b/includes/tlasharptla-ie7-md.md
deleted file mode 100644
index 7e19a10469c..00000000000
--- a/includes/tlasharptla-ie7-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Internet Explorer 7
\ No newline at end of file
diff --git a/includes/tlasharptla-iegeneric-md.md b/includes/tlasharptla-iegeneric-md.md
deleted file mode 100644
index 2563bf1452e..00000000000
--- a/includes/tlasharptla-iegeneric-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Internet Explorer
\ No newline at end of file
diff --git a/includes/tlasharptla-ifd-md.md b/includes/tlasharptla-ifd-md.md
deleted file mode 100644
index 6247f5e998b..00000000000
--- a/includes/tlasharptla-ifd-md.md
+++ /dev/null
@@ -1 +0,0 @@
-image file directory (IFD)
\ No newline at end of file
diff --git a/includes/tlasharptla-ime-md.md b/includes/tlasharptla-ime-md.md
deleted file mode 100644
index 25a7853fe8d..00000000000
--- a/includes/tlasharptla-ime-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Input Method Editor (IME)
\ No newline at end of file
diff --git a/includes/tlasharptla-iptc-md.md b/includes/tlasharptla-iptc-md.md
deleted file mode 100644
index ee25250a1cf..00000000000
--- a/includes/tlasharptla-iptc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-International Press Telecommunications Council (IPTC)
\ No newline at end of file
diff --git a/includes/tlasharptla-isf-md.md b/includes/tlasharptla-isf-md.md
deleted file mode 100644
index 51c6a562d55..00000000000
--- a/includes/tlasharptla-isf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Ink Serialized Format (ISF)
\ No newline at end of file
diff --git a/includes/tlasharptla-isv-md.md b/includes/tlasharptla-isv-md.md
deleted file mode 100644
index 7bc9c9b3dc2..00000000000
--- a/includes/tlasharptla-isv-md.md
+++ /dev/null
@@ -1 +0,0 @@
-independent software vendor (ISV)
\ No newline at end of file
diff --git a/includes/tlasharptla-jpeg-md.md b/includes/tlasharptla-jpeg-md.md
deleted file mode 100644
index d4d1537f685..00000000000
--- a/includes/tlasharptla-jpeg-md.md
+++ /dev/null
@@ -1 +0,0 @@
-JPEG
\ No newline at end of file
diff --git a/includes/tlasharptla-jpegorg-md.md b/includes/tlasharptla-jpegorg-md.md
deleted file mode 100644
index 5936d841425..00000000000
--- a/includes/tlasharptla-jpegorg-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Joint Photographics Experts Group (JPEG)
\ No newline at end of file
diff --git a/includes/tlasharptla-longhorn-md.md b/includes/tlasharptla-longhorn-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/tlasharptla-longhorn-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/tlasharptla-mdi-md.md b/includes/tlasharptla-mdi-md.md
deleted file mode 100644
index a1caa7f98b6..00000000000
--- a/includes/tlasharptla-mdi-md.md
+++ /dev/null
@@ -1 +0,0 @@
-multiple-document interface (MDI)
\ No newline at end of file
diff --git a/includes/tlasharptla-mime-md.md b/includes/tlasharptla-mime-md.md
deleted file mode 100644
index dfe9753fb7a..00000000000
--- a/includes/tlasharptla-mime-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Multipurpose Internet Mail Extensions (MIME)
\ No newline at end of file
diff --git a/includes/tlasharptla-ms-md.md b/includes/tlasharptla-ms-md.md
deleted file mode 100644
index a04fcf98800..00000000000
--- a/includes/tlasharptla-ms-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft
\ No newline at end of file
diff --git a/includes/tlasharptla-msbuild-md.md b/includes/tlasharptla-msbuild-md.md
deleted file mode 100644
index 574f41e51c4..00000000000
--- a/includes/tlasharptla-msbuild-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft build engine (MSBuild)
\ No newline at end of file
diff --git a/includes/tlasharptla-mswin-md.md b/includes/tlasharptla-mswin-md.md
deleted file mode 100644
index 1058cb39495..00000000000
--- a/includes/tlasharptla-mswin-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows
\ No newline at end of file
diff --git a/includes/tlasharptla-net-md.md b/includes/tlasharptla-net-md.md
deleted file mode 100644
index ed5316af359..00000000000
--- a/includes/tlasharptla-net-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft .NET
\ No newline at end of file
diff --git a/includes/tlasharptla-netframewkattr-md.md b/includes/tlasharptla-netframewkattr-md.md
deleted file mode 100644
index ee303926c37..00000000000
--- a/includes/tlasharptla-netframewkattr-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework attribute
\ No newline at end of file
diff --git a/includes/tlasharptla-netframewkattrsharpplural-md.md b/includes/tlasharptla-netframewkattrsharpplural-md.md
deleted file mode 100644
index 453dbfb6f67..00000000000
--- a/includes/tlasharptla-netframewkattrsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-.NET Framework attributes
\ No newline at end of file
diff --git a/includes/tlasharptla-opentype-md.md b/includes/tlasharptla-opentype-md.md
deleted file mode 100644
index fad0b0bfa09..00000000000
--- a/includes/tlasharptla-opentype-md.md
+++ /dev/null
@@ -1 +0,0 @@
-OpenType
\ No newline at end of file
diff --git a/includes/tlasharptla-outlook-md.md b/includes/tlasharptla-outlook-md.md
deleted file mode 100644
index 624028563d0..00000000000
--- a/includes/tlasharptla-outlook-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Outlook
\ No newline at end of file
diff --git a/includes/tlasharptla-passport-md.md b/includes/tlasharptla-passport-md.md
deleted file mode 100644
index 46ca96f199f..00000000000
--- a/includes/tlasharptla-passport-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Live ID
\ No newline at end of file
diff --git a/includes/tlasharptla-png-md.md b/includes/tlasharptla-png-md.md
deleted file mode 100644
index 1f7bd6dabcc..00000000000
--- a/includes/tlasharptla-png-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Portable Network Graphics (PNG)
\ No newline at end of file
diff --git a/includes/tlasharptla-riff-md.md b/includes/tlasharptla-riff-md.md
deleted file mode 100644
index 53d4b8443d0..00000000000
--- a/includes/tlasharptla-riff-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Resource Interchange File Format (RIFF)
\ No newline at end of file
diff --git a/includes/tlasharptla-rtf-md.md b/includes/tlasharptla-rtf-md.md
deleted file mode 100644
index 9a376842ab5..00000000000
--- a/includes/tlasharptla-rtf-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Rich Text Format (RTF)
\ No newline at end of file
diff --git a/includes/tlasharptla-sha1-md.md b/includes/tlasharptla-sha1-md.md
deleted file mode 100644
index 2b48d240e1c..00000000000
--- a/includes/tlasharptla-sha1-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Secure Hash Algorithm version 1.0 (SHA1)
\ No newline at end of file
diff --git a/includes/tlasharptla-tiff-md.md b/includes/tlasharptla-tiff-md.md
deleted file mode 100644
index 68948a6cc5f..00000000000
--- a/includes/tlasharptla-tiff-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Tagged Image File Format (TIFF)
\ No newline at end of file
diff --git a/includes/tlasharptla-titlewinclient-md.md b/includes/tlasharptla-titlewinclient-md.md
deleted file mode 100644
index 92826b01ec3..00000000000
--- a/includes/tlasharptla-titlewinclient-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WPF
\ No newline at end of file
diff --git a/includes/tlasharptla-titlexaml-md.md b/includes/tlasharptla-titlexaml-md.md
deleted file mode 100644
index 7d3d6afaedc..00000000000
--- a/includes/tlasharptla-titlexaml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML
\ No newline at end of file
diff --git a/includes/tlasharptla-tpc-md.md b/includes/tlasharptla-tpc-md.md
deleted file mode 100644
index 834bcfc55be..00000000000
--- a/includes/tlasharptla-tpc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Tablet PC
\ No newline at end of file
diff --git a/includes/tlasharptla-ui-md.md b/includes/tlasharptla-ui-md.md
deleted file mode 100644
index c1dd193547c..00000000000
--- a/includes/tlasharptla-ui-md.md
+++ /dev/null
@@ -1 +0,0 @@
-user interface (UI)
\ No newline at end of file
diff --git a/includes/tlasharptla-uiautomation-md.md b/includes/tlasharptla-uiautomation-md.md
deleted file mode 100644
index 0ce40bf644c..00000000000
--- a/includes/tlasharptla-uiautomation-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft UI Automation
\ No newline at end of file
diff --git a/includes/tlasharptla-uiautomationsharpinitcap-md.md b/includes/tlasharptla-uiautomationsharpinitcap-md.md
deleted file mode 100644
index c8f4954a9c8..00000000000
--- a/includes/tlasharptla-uiautomationsharpinitcap-md.md
+++ /dev/null
@@ -1 +0,0 @@
-UI Automation
\ No newline at end of file
diff --git a/includes/tlasharptla-unc-md.md b/includes/tlasharptla-unc-md.md
deleted file mode 100644
index bc412a4c57b..00000000000
--- a/includes/tlasharptla-unc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Universal Naming Convention (UNC)
\ No newline at end of file
diff --git a/includes/tlasharptla-unicode-md.md b/includes/tlasharptla-unicode-md.md
deleted file mode 100644
index a0388044512..00000000000
--- a/includes/tlasharptla-unicode-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Unicode
\ No newline at end of file
diff --git a/includes/tlasharptla-url-md.md b/includes/tlasharptla-url-md.md
deleted file mode 100644
index e6a755c451b..00000000000
--- a/includes/tlasharptla-url-md.md
+++ /dev/null
@@ -1 +0,0 @@
-URL
\ No newline at end of file
diff --git a/includes/tlasharptla-visualstu-md.md b/includes/tlasharptla-visualstu-md.md
deleted file mode 100644
index 5f8ebc7ff9a..00000000000
--- a/includes/tlasharptla-visualstu-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Visual Studio
\ No newline at end of file
diff --git a/includes/tlasharptla-wdp-md.md b/includes/tlasharptla-wdp-md.md
deleted file mode 100644
index d184490a59f..00000000000
--- a/includes/tlasharptla-wdp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows Media Photo
\ No newline at end of file
diff --git a/includes/tlasharptla-win-md.md b/includes/tlasharptla-win-md.md
deleted file mode 100644
index 09919ea7bee..00000000000
--- a/includes/tlasharptla-win-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows
\ No newline at end of file
diff --git a/includes/tlasharptla-win32-md.md b/includes/tlasharptla-win32-md.md
deleted file mode 100644
index df14f554429..00000000000
--- a/includes/tlasharptla-win32-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Win32
\ No newline at end of file
diff --git a/includes/tlasharptla-winclient-md.md b/includes/tlasharptla-winclient-md.md
deleted file mode 100644
index ec2f2b4ecea..00000000000
--- a/includes/tlasharptla-winclient-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Presentation Foundation (WPF)
\ No newline at end of file
diff --git a/includes/tlasharptla-winexpl-md.md b/includes/tlasharptla-winexpl-md.md
deleted file mode 100644
index 050c02289e3..00000000000
--- a/includes/tlasharptla-winexpl-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows Explorer
\ No newline at end of file
diff --git a/includes/tlasharptla-winforms-md.md b/includes/tlasharptla-winforms-md.md
deleted file mode 100644
index cc70f580d7d..00000000000
--- a/includes/tlasharptla-winforms-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Forms
\ No newline at end of file
diff --git a/includes/tlasharptla-winfxwebapp-md.md b/includes/tlasharptla-winfxwebapp-md.md
deleted file mode 100644
index a538161e413..00000000000
--- a/includes/tlasharptla-winfxwebapp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML browser application (XBAP)
\ No newline at end of file
diff --git a/includes/tlasharptla-winnetsvrfam-md.md b/includes/tlasharptla-winnetsvrfam-md.md
deleted file mode 100644
index e20849463a2..00000000000
--- a/includes/tlasharptla-winnetsvrfam-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows Server 2003
\ No newline at end of file
diff --git a/includes/tlasharptla-winvista-md.md b/includes/tlasharptla-winvista-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/tlasharptla-winvista-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/tlasharptla-winxp-md.md b/includes/tlasharptla-winxp-md.md
deleted file mode 100644
index e0723a78af5..00000000000
--- a/includes/tlasharptla-winxp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows XP
\ No newline at end of file
diff --git a/includes/tlasharptla-wmp-md.md b/includes/tlasharptla-wmp-md.md
deleted file mode 100644
index 64ccfac2dc7..00000000000
--- a/includes/tlasharptla-wmp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Windows Media Player
\ No newline at end of file
diff --git a/includes/tlasharptla-word-md.md b/includes/tlasharptla-word-md.md
deleted file mode 100644
index 4c0765a254f..00000000000
--- a/includes/tlasharptla-word-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Word
\ No newline at end of file
diff --git a/includes/tlasharptla-wys-md.md b/includes/tlasharptla-wys-md.md
deleted file mode 100644
index 145a582eaa0..00000000000
--- a/includes/tlasharptla-wys-md.md
+++ /dev/null
@@ -1 +0,0 @@
-"what you see is what you get" (WYSIWYG)
\ No newline at end of file
diff --git a/includes/tlasharptla-xaml-md.md b/includes/tlasharptla-xaml-md.md
deleted file mode 100644
index 64155c7f9ba..00000000000
--- a/includes/tlasharptla-xaml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Extensible Application Markup Language (XAML)
\ No newline at end of file
diff --git a/includes/tlasharptla-xbap-md.md b/includes/tlasharptla-xbap-md.md
deleted file mode 100644
index a538161e413..00000000000
--- a/includes/tlasharptla-xbap-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML browser application (XBAP)
\ No newline at end of file
diff --git a/includes/tlasharptla-xbapsharpplural-md.md b/includes/tlasharptla-xbapsharpplural-md.md
deleted file mode 100644
index 9af96f3a115..00000000000
--- a/includes/tlasharptla-xbapsharpplural-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML browser applications (XBAPs)
\ No newline at end of file
diff --git a/includes/tlasharptla-xl-md.md b/includes/tlasharptla-xl-md.md
deleted file mode 100644
index 45a379d7eac..00000000000
--- a/includes/tlasharptla-xl-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Excel
\ No newline at end of file
diff --git a/includes/tlasharptla-xml-md.md b/includes/tlasharptla-xml-md.md
deleted file mode 100644
index f86a2f5fe92..00000000000
--- a/includes/tlasharptla-xml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XML
\ No newline at end of file
diff --git a/includes/tlasharptla-xmldom-md.md b/includes/tlasharptla-xmldom-md.md
deleted file mode 100644
index 616fe700d83..00000000000
--- a/includes/tlasharptla-xmldom-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XML Document Object Model (DOM)
\ No newline at end of file
diff --git a/includes/tlasharptla-xmp-md.md b/includes/tlasharptla-xmp-md.md
deleted file mode 100644
index 25a4fdd4209..00000000000
--- a/includes/tlasharptla-xmp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Extensible Metadata Platform (XMP)
\ No newline at end of file
diff --git a/includes/tlasharptla-xps-md.md b/includes/tlasharptla-xps-md.md
deleted file mode 100644
index b0d87920a46..00000000000
--- a/includes/tlasharptla-xps-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XML Paper Specification (XPS)
\ No newline at end of file
diff --git a/includes/tlasharptla-xrml-md.md b/includes/tlasharptla-xrml-md.md
deleted file mode 100644
index ee16d7b501a..00000000000
--- a/includes/tlasharptla-xrml-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Extensible Rights Markup Language (XrML)
\ No newline at end of file
diff --git a/includes/tlasharptla-xsd-md.md b/includes/tlasharptla-xsd-md.md
deleted file mode 100644
index 32a590084be..00000000000
--- a/includes/tlasharptla-xsd-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XML Schema Definition (XSD)
\ No newline at end of file
diff --git a/includes/tsql-md.md b/includes/tsql-md.md
deleted file mode 100644
index 4b57ddad132..00000000000
--- a/includes/tsql-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Transact-SQL
\ No newline at end of file
diff --git a/includes/vb-orcas-long-md.md b/includes/vb-orcas-long-md.md
deleted file mode 100644
index 5ea91318d24..00000000000
--- a/includes/vb-orcas-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Basic 2008
\ No newline at end of file
diff --git a/includes/vbprvbext-md.md b/includes/vbprvbext-md.md
deleted file mode 100644
index d2677871c70..00000000000
--- a/includes/vbprvbext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Visual Basic 2005
\ No newline at end of file
diff --git a/includes/vbprvblong-md.md b/includes/vbprvblong-md.md
deleted file mode 100644
index 34139d90424..00000000000
--- a/includes/vbprvblong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Basic 2005
\ No newline at end of file
diff --git a/includes/vbtecdlinq-md.md b/includes/vbtecdlinq-md.md
deleted file mode 100644
index 52781fca7e9..00000000000
--- a/includes/vbtecdlinq-md.md
+++ /dev/null
@@ -1 +0,0 @@
-LINQ to SQL
\ No newline at end of file
diff --git a/includes/vbteclinq-md.md b/includes/vbteclinq-md.md
deleted file mode 100644
index 28c6d25f691..00000000000
--- a/includes/vbteclinq-md.md
+++ /dev/null
@@ -1 +0,0 @@
-LINQ
\ No newline at end of file
diff --git a/includes/vbteclinqext-md.md b/includes/vbteclinqext-md.md
deleted file mode 100644
index 37f0a0f69df..00000000000
--- a/includes/vbteclinqext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Language-Integrated Query (LINQ)
\ No newline at end of file
diff --git a/includes/vcprvc-md.md b/includes/vcprvc-md.md
deleted file mode 100644
index c6d2435e98d..00000000000
--- a/includes/vcprvc-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual C++
\ No newline at end of file
diff --git a/includes/vcprvclong-md.md b/includes/vcprvclong-md.md
deleted file mode 100644
index ed8b3171d49..00000000000
--- a/includes/vcprvclong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual C++ 2005
\ No newline at end of file
diff --git a/includes/vs-dev10-long-md.md b/includes/vs-dev10-long-md.md
deleted file mode 100644
index eaf2ee2b1c2..00000000000
--- a/includes/vs-dev10-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Studio 2010
\ No newline at end of file
diff --git a/includes/vs-dev11-long-md.md b/includes/vs-dev11-long-md.md
deleted file mode 100644
index e42d5412a81..00000000000
--- a/includes/vs-dev11-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Studio 2012
\ No newline at end of file
diff --git a/includes/vs-orcas-ext-md.md b/includes/vs-orcas-ext-md.md
deleted file mode 100644
index 9e6c99a9c07..00000000000
--- a/includes/vs-orcas-ext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Visual Studio 2008
\ No newline at end of file
diff --git a/includes/vs-orcas-long-md.md b/includes/vs-orcas-long-md.md
deleted file mode 100644
index 80f0fb84087..00000000000
--- a/includes/vs-orcas-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Studio 2008
\ No newline at end of file
diff --git a/includes/vs-ordesigner-long-md.md b/includes/vs-ordesigner-long-md.md
deleted file mode 100644
index 00424e0c8fe..00000000000
--- a/includes/vs-ordesigner-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Object Relational Designer
\ No newline at end of file
diff --git a/includes/vs-ordesigner-short-md.md b/includes/vs-ordesigner-short-md.md
deleted file mode 100644
index 8595f697c07..00000000000
--- a/includes/vs-ordesigner-short-md.md
+++ /dev/null
@@ -1 +0,0 @@
-O/R Designer
\ No newline at end of file
diff --git a/includes/vs2010-md.md b/includes/vs2010-md.md
deleted file mode 100644
index eaf2ee2b1c2..00000000000
--- a/includes/vs2010-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Studio 2010
\ No newline at end of file
diff --git a/includes/vsprvsext-md.md b/includes/vsprvsext-md.md
deleted file mode 100644
index aedf061c2e3..00000000000
--- a/includes/vsprvsext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Microsoft Visual Studio 2005
\ No newline at end of file
diff --git a/includes/vsprvslong-md.md b/includes/vsprvslong-md.md
deleted file mode 100644
index 33fb76fddc1..00000000000
--- a/includes/vsprvslong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Studio 2005
\ No newline at end of file
diff --git a/includes/vstecado-md.md b/includes/vstecado-md.md
deleted file mode 100644
index 7b6552e6405..00000000000
--- a/includes/vstecado-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ADO.NET
\ No newline at end of file
diff --git a/includes/vstecasp-md.md b/includes/vstecasp-md.md
deleted file mode 100644
index f41705de76e..00000000000
--- a/includes/vstecasp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ASP.NET
\ No newline at end of file
diff --git a/includes/vstecasplong-md.md b/includes/vstecasplong-md.md
deleted file mode 100644
index 04bf8881097..00000000000
--- a/includes/vstecasplong-md.md
+++ /dev/null
@@ -1 +0,0 @@
-ASP.NET 2.0
\ No newline at end of file
diff --git a/includes/vstecmsbuild-md.md b/includes/vstecmsbuild-md.md
deleted file mode 100644
index 3ff1ea73f85..00000000000
--- a/includes/vstecmsbuild-md.md
+++ /dev/null
@@ -1 +0,0 @@
-MSBuild
\ No newline at end of file
diff --git a/includes/vwd-exp-dev10-long-md.md b/includes/vwd-exp-dev10-long-md.md
deleted file mode 100644
index deb193b53a6..00000000000
--- a/includes/vwd-exp-dev10-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Web Developer 2010 Express
\ No newline at end of file
diff --git a/includes/vwd-exp-orcas-long-md.md b/includes/vwd-exp-orcas-long-md.md
deleted file mode 100644
index 07cb50fb027..00000000000
--- a/includes/vwd-exp-orcas-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Web Developer 2008 Express Edition
\ No newline at end of file
diff --git a/includes/vwprvw-md.md b/includes/vwprvw-md.md
deleted file mode 100644
index fda902d1c55..00000000000
--- a/includes/vwprvw-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Visual Web Developer
\ No newline at end of file
diff --git a/includes/wf1-md.md b/includes/wf1-md.md
deleted file mode 100644
index c99b2aafaa7..00000000000
--- a/includes/wf1-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WF
\ No newline at end of file
diff --git a/includes/wfd1-md.md b/includes/wfd1-md.md
deleted file mode 100644
index 133d69850a6..00000000000
--- a/includes/wfd1-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Workflow Designer
\ No newline at end of file
diff --git a/includes/wfd2-md.md b/includes/wfd2-md.md
deleted file mode 100644
index 0de80648538..00000000000
--- a/includes/wfd2-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Workflow Designer
\ No newline at end of file
diff --git a/includes/win2kfamily-md.md b/includes/win2kfamily-md.md
deleted file mode 100644
index e93c2ee2f25..00000000000
--- a/includes/win2kfamily-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 2000
\ No newline at end of file
diff --git a/includes/win2kserver-md.md b/includes/win2kserver-md.md
deleted file mode 100644
index ce3432feecb..00000000000
--- a/includes/win2kserver-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 2000 Server
\ No newline at end of file
diff --git a/includes/win7-md.md b/includes/win7-md.md
deleted file mode 100644
index 0bef53745cf..00000000000
--- a/includes/win7-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 7
\ No newline at end of file
diff --git a/includes/win8-appname-long-md.md b/includes/win8-appname-long-md.md
deleted file mode 100644
index 8bb01190c87..00000000000
--- a/includes/win8-appname-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 8.x Store
\ No newline at end of file
diff --git a/includes/win8-appstore-long-md.md b/includes/win8-appstore-long-md.md
deleted file mode 100644
index 6b3948f8c25..00000000000
--- a/includes/win8-appstore-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Store
\ No newline at end of file
diff --git a/includes/win8-md.md b/includes/win8-md.md
deleted file mode 100644
index f851b514732..00000000000
--- a/includes/win8-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 8
\ No newline at end of file
diff --git a/includes/win81-md.md b/includes/win81-md.md
deleted file mode 100644
index bcc2351f5f1..00000000000
--- a/includes/win81-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows 8.1
\ No newline at end of file
diff --git a/includes/wince-md.md b/includes/wince-md.md
deleted file mode 100644
index a691fb6712b..00000000000
--- a/includes/wince-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Embedded CE
\ No newline at end of file
diff --git a/includes/windowsver-md.md b/includes/windowsver-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/windowsver-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/winnt4family-md.md b/includes/winnt4family-md.md
deleted file mode 100644
index 1c3e369f6d9..00000000000
--- a/includes/winnt4family-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows NT 4.0
\ No newline at end of file
diff --git a/includes/winxp-md.md b/includes/winxp-md.md
deleted file mode 100644
index 936c76a97d4..00000000000
--- a/includes/winxp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows XP
\ No newline at end of file
diff --git a/includes/winxpfamily-md.md b/includes/winxpfamily-md.md
deleted file mode 100644
index 6cb77eb13b5..00000000000
--- a/includes/winxpfamily-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows XP Home Edition, Windows XP Professional, Windows Server 2003
\ No newline at end of file
diff --git a/includes/winxppro-md.md b/includes/winxppro-md.md
deleted file mode 100644
index 15f02f47fdc..00000000000
--- a/includes/winxppro-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows XP Professional
\ No newline at end of file
diff --git a/includes/winxpsvr-md.md b/includes/winxpsvr-md.md
deleted file mode 100644
index 5e9d928e681..00000000000
--- a/includes/winxpsvr-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Server 2003
\ No newline at end of file
diff --git a/includes/wiprlhext-md.md b/includes/wiprlhext-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/wiprlhext-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/wpfdesigner-current-long-md.md b/includes/wpfdesigner-current-long-md.md
deleted file mode 100644
index 82e1233fccc..00000000000
--- a/includes/wpfdesigner-current-long-md.md
+++ /dev/null
@@ -1 +0,0 @@
-WPF Designer for Visual Studio
\ No newline at end of file
diff --git a/includes/wrt-md.md b/includes/wrt-md.md
deleted file mode 100644
index 4e62e3076ab..00000000000
--- a/includes/wrt-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Runtime
\ No newline at end of file
diff --git a/includes/ws2003-md.md b/includes/ws2003-md.md
deleted file mode 100644
index 5e9d928e681..00000000000
--- a/includes/ws2003-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Server 2003
\ No newline at end of file
diff --git a/includes/wv-md.md b/includes/wv-md.md
deleted file mode 100644
index 394a749f72d..00000000000
--- a/includes/wv-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows Vista
\ No newline at end of file
diff --git a/includes/wxp-md.md b/includes/wxp-md.md
deleted file mode 100644
index 936c76a97d4..00000000000
--- a/includes/wxp-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows XP
\ No newline at end of file
diff --git a/includes/wxpsp2-md.md b/includes/wxpsp2-md.md
deleted file mode 100644
index 04a512a7f73..00000000000
--- a/includes/wxpsp2-md.md
+++ /dev/null
@@ -1 +0,0 @@
-Windows XP SP2
\ No newline at end of file
diff --git a/includes/xaml2009-md.md b/includes/xaml2009-md.md
deleted file mode 100644
index bfa2288600a..00000000000
--- a/includes/xaml2009-md.md
+++ /dev/null
@@ -1 +0,0 @@
-XAML2009
\ No newline at end of file
diff --git a/xml/Microsoft.Build.BuildEngine/BuildItem.xml b/xml/Microsoft.Build.BuildEngine/BuildItem.xml
index f5f1d297588..2ba14b2637a 100644
--- a/xml/Microsoft.Build.BuildEngine/BuildItem.xml
+++ b/xml/Microsoft.Build.BuildEngine/BuildItem.xml
@@ -655,7 +655,7 @@
The item metadata name.
The item metadata value.
- to treat the metadata as a literal value by escaping all [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] special characters; otherwise, .
+ to treat the metadata as a literal value by escaping all MSBuild special characters; otherwise, .
Assigns the specified value to the specified item metadata, and optionally treats the metadata as a literal value.
To be added.
diff --git a/xml/Microsoft.Build.BuildEngine/Engine.xml b/xml/Microsoft.Build.BuildEngine/Engine.xml
index 27a6340c0d8..0ebdb2dc3d6 100644
--- a/xml/Microsoft.Build.BuildEngine/Engine.xml
+++ b/xml/Microsoft.Build.BuildEngine/Engine.xml
@@ -240,9 +240,9 @@
A that represents properties to be passed to the child engine.
A enumeration specifies the location of the Toolset definition.
An integer that specifies the number of CPUs or cores in the system.
- A string of parameters that are used to configure the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] engine. You must format the parameters as =. The valid semicolon-separated, optional parameters are as follows:
+ A string of parameters that are used to configure the MSBuild engine. You must format the parameters as =. The valid semicolon-separated, optional parameters are as follows:
- Indicates where the build process can find MSBuild.exe. This path enables the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] engine to locate MSBuild.exe and start it as a local node. is the only essential parameter for a host. The default value is C:\Windows\Microsoft.Net\Framework\v3.5\\.
+ Indicates where the build process can find MSBuild.exe. This path enables the MSBuild engine to locate MSBuild.exe and start it as a local node. is the only essential parameter for a host. The default value is C:\Windows\Microsoft.Net\Framework\v3.5\\.
Indicates whether the child nodes should remain after the build finishes, in case they can be used later by another build. The nodes are discarded automatically after one minute of non-use. The default value is .
Initializes a new instance of the class.
@@ -279,7 +279,7 @@
represents an [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] project. It is a container for items, properties and targets. It can load project content from in-memory XML or from an XML file, and can save to an XML file, preserving most white space and all XML comments.
+ A represents an MSBuild project. It is a container for items, properties and targets. It can load project content from in-memory XML or from an XML file, and can save to an XML file, preserving most white space and all XML comments.
Every must be associated with an to access shared information. During a build, the object keeps track of which projects are currently building.
diff --git a/xml/Microsoft.Build.BuildEngine/Utilities.xml b/xml/Microsoft.Build.BuildEngine/Utilities.xml
index 63f141a6306..f5b594dc687 100644
--- a/xml/Microsoft.Build.BuildEngine/Utilities.xml
+++ b/xml/Microsoft.Build.BuildEngine/Utilities.xml
@@ -42,13 +42,13 @@
The string to convert.
- Converts the specified string into a syntax that allows the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] engine to interpret the character literally.
+ Converts the specified string into a syntax that allows the MSBuild engine to interpret the character literally.
The converted value of the specified string.
diff --git a/xml/Microsoft.Build.Evaluation/Toolset.xml b/xml/Microsoft.Build.Evaluation/Toolset.xml
index a5d30088bd9..5135a660b72 100644
--- a/xml/Microsoft.Build.Evaluation/Toolset.xml
+++ b/xml/Microsoft.Build.Evaluation/Toolset.xml
@@ -183,9 +183,9 @@
diff --git a/xml/Microsoft.Build.Framework/ILogger.xml b/xml/Microsoft.Build.Framework/ILogger.xml
index 654ada6bbcd..7936434c193 100644
--- a/xml/Microsoft.Build.Framework/ILogger.xml
+++ b/xml/Microsoft.Build.Framework/ILogger.xml
@@ -28,7 +28,7 @@
, which provides default implementations of some members.
diff --git a/xml/Microsoft.Build.Framework/OutputAttribute.xml b/xml/Microsoft.Build.Framework/OutputAttribute.xml
index 96d8a7015dd..98a829faeeb 100644
--- a/xml/Microsoft.Build.Framework/OutputAttribute.xml
+++ b/xml/Microsoft.Build.Framework/OutputAttribute.xml
@@ -33,7 +33,7 @@
indicates that it has a stricter runtime requirement than a regular task. It alerts MSBuild that it may need to start a separate process for the task if the current CLR runtime version does not match the required version.
> [!NOTE]
-> This attribute is currently non-functional because only one version of the CLR (2.0) is capable of running either [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] version 2.0 or 3.5.
+> This attribute is currently non-functional because only one version of the CLR (2.0) is capable of running either MSBuild version 2.0 or 3.5.
For more information about using attributes, see [Extending Metadata Using Attributes](/dotnet/standard/attributes/).
diff --git a/xml/Microsoft.Build.Framework/TaskFinishedEventArgs.xml b/xml/Microsoft.Build.Framework/TaskFinishedEventArgs.xml
index 62cfb9b659a..7428182a5f6 100644
--- a/xml/Microsoft.Build.Framework/TaskFinishedEventArgs.xml
+++ b/xml/Microsoft.Build.Framework/TaskFinishedEventArgs.xml
@@ -232,7 +232,7 @@
MSBuild file where this task was defined.
- The [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] file where the task is defined.
+ The MSBuild file where the task is defined.
To be added.
diff --git a/xml/Microsoft.Build.Framework/TaskStartedEventArgs.xml b/xml/Microsoft.Build.Framework/TaskStartedEventArgs.xml
index b74c5174070..764aa9b0958 100644
--- a/xml/Microsoft.Build.Framework/TaskStartedEventArgs.xml
+++ b/xml/Microsoft.Build.Framework/TaskStartedEventArgs.xml
@@ -196,7 +196,7 @@
MSBuild file where this task was defined.
- The [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] file where the task was defined.
+ The MSBuild file where the task was defined.
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/CompatibleFramework.xml b/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/CompatibleFramework.xml
index a5a60ff7e4b..1e474115e8b 100644
--- a/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/CompatibleFramework.xml
+++ b/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/CompatibleFramework.xml
@@ -97,7 +97,7 @@
diff --git a/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/SecurityUtilities.xml b/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/SecurityUtilities.xml
index b0e141d6a72..7af019892d9 100644
--- a/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/SecurityUtilities.xml
+++ b/xml/Microsoft.Build.Tasks.Deployment.ManifestUtilities/SecurityUtilities.xml
@@ -254,7 +254,7 @@
diff --git a/xml/Microsoft.Build.Tasks.Hosting/ICscHostObject.xml b/xml/Microsoft.Build.Tasks.Hosting/ICscHostObject.xml
index dc69fd86d6e..7b00468a505 100644
--- a/xml/Microsoft.Build.Tasks.Hosting/ICscHostObject.xml
+++ b/xml/Microsoft.Build.Tasks.Hosting/ICscHostObject.xml
@@ -957,8 +957,8 @@
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to link to the output file.
- Creates links to the specified [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources in the output file; the resource files are not placed in the output file.
+ The .NET Framework resources to link to the output file.
+ Creates links to the specified .NET Framework resources in the output file; the resource files are not placed in the output file.
if the method was successful; otherwise, .
To be added.
@@ -1342,8 +1342,8 @@
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed into the output file.
- Specifies the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed into the output file.
+ The .NET Framework resources to embed into the output file.
+ Specifies the .NET Framework resources to embed into the output file.
if the method was successful; otherwise, .
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Hosting/IVbcHostObject.xml b/xml/Microsoft.Build.Tasks.Hosting/IVbcHostObject.xml
index a673b1d0cdb..66998f9545e 100644
--- a/xml/Microsoft.Build.Tasks.Hosting/IVbcHostObject.xml
+++ b/xml/Microsoft.Build.Tasks.Hosting/IVbcHostObject.xml
@@ -835,8 +835,8 @@
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to link to the output file.
- Creates links to the specified [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources in the output file; the resource files are not placed in the output file.
+ The .NET Framework resources to link to the output file.
+ Creates links to the specified .NET Framework resources in the output file; the resource files are not placed in the output file.
if the method was successful; otherwise, .
To be added.
@@ -1374,8 +1374,8 @@
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed into the output file.
- Specifies the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed into the output file.
+ The .NET Framework resources to embed into the output file.
+ Specifies the .NET Framework resources to embed into the output file.
if the method was successful; otherwise, .
To be added.
@@ -1565,8 +1565,8 @@
- to target the [!INCLUDE[Compact](~/includes/compact-md.md)]; otherwise, .
- Specifies a value indicating whether to target the [!INCLUDE[Compact](~/includes/compact-md.md)].
+ to target the .NET Compact Framework; otherwise, .
+ Specifies a value indicating whether to target the .NET Compact Framework.
if the method was successful; otherwise, .
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass1.xml b/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass1.xml
index 24abe7315ef..f090151e4d2 100644
--- a/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass1.xml
+++ b/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass1.xml
@@ -144,8 +144,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the name of the application definition [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] file.
- The name of the application definition [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] file.
+ Gets or sets the name of the application definition XAML file.
+ The name of the application definition XAML file.
To be added.
@@ -347,7 +347,7 @@
Gets or sets a value that specifies whether the current value of **DefineConstants** is kept.
- Specifies whether the current value of **DefineConstants** is kept, which affects target assembly generation; if this parameter is changed, the public API in the target assembly may be changed and the compilation of [!INCLUDE[TLA2#tla_titlexaml](~/includes/tla2sharptla-titlexaml-md.md)] files that reference local types may be affected.
+ Specifies whether the current value of **DefineConstants** is kept, which affects target assembly generation; if this parameter is changed, the public API in the target assembly may be changed and the compilation of XAML files that reference local types may be affected.
To be added.
@@ -437,8 +437,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
- The generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
+ Gets or sets the generated binary XAML (BAML) files.
+ The generated binary XAML (BAML) files.
To be added.
@@ -503,8 +503,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the generated localization file for each localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] file.
- The generated localization file for each localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] file.
+ Gets or sets the generated localization file for each localizable XAML file.
+ The generated localization file for each localizable XAML file.
To be added.
@@ -532,9 +532,9 @@
System.String
- Gets or sets a value that indicates whether the generated assembly is a [!INCLUDE[TLA#tla_xbap](~/includes/tlasharptla-xbap-md.md)].
+ Gets or sets a value that indicates whether the generated assembly is a XAML browser application (XBAP).
- if the generated assembly is a [!INCLUDE[TLA#tla_xbap](~/includes/tlasharptla-xbap-md.md)]; otherwise, .
+ if the generated assembly is a XAML browser application (XBAP); otherwise, .
To be added.
@@ -682,8 +682,8 @@
System.String
- Gets or sets a value that specifies how to generate localization information for each [!INCLUDE[TLA#tla_xaml](~/includes/tlasharptla-xaml-md.md)] file.
- A value that specifies how to generate localization information for each [!INCLUDE[TLA#tla_xaml](~/includes/tlasharptla-xaml-md.md)] file. The valid values are **None**, **CommentsOnly**, and **All**.
+ Gets or sets a value that specifies how to generate localization information for each Extensible Application Markup Language (XAML) file.
+ A value that specifies how to generate localization information for each Extensible Application Markup Language (XAML) file. The valid values are **None**, **CommentsOnly**, and **All**.
To be added.
@@ -781,8 +781,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets a list of [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files to process.
- A list of [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files to process.
+ Gets or sets a list of XAML files to process.
+ A list of XAML files to process.
To be added.
@@ -851,9 +851,9 @@
System.Boolean
- Gets or sets a value that indicates whether the project contains non-localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that reference local types that are embedded into the main assembly.
+ Gets or sets a value that indicates whether the project contains non-localizable XAML files that reference local types that are embedded into the main assembly.
- if project contains non-localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that reference local types that are embedded into the main assembly.; otherwise, .
+ if project contains non-localizable XAML files that reference local types that are embedded into the main assembly.; otherwise, .
To be added.
@@ -889,9 +889,9 @@
System.Boolean
- Gets or sets a value that indicates whether the project contains localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that reference local types that are embedded in the satellite assembly.
+ Gets or sets a value that indicates whether the project contains localizable XAML files that reference local types that are embedded in the satellite assembly.
- if the p project contains localizable [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that reference local types that are embedded in the satellite assembly; otherwise, .
+ if the p project contains localizable XAML files that reference local types that are embedded in the satellite assembly; otherwise, .
To be added.
@@ -1022,8 +1022,8 @@
System.String
- Gets or sets a value that specifies which culture satellite assembly will hold the generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
- A a value that specifies which culture satellite assembly will hold the generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
+ Gets or sets a value that specifies which culture satellite assembly will hold the generated binary XAML (BAML) files.
+ A a value that specifies which culture satellite assembly will hold the generated binary XAML (BAML) files.
To be added.
@@ -1055,9 +1055,9 @@
System.Boolean
- Gets or sets a value that indicates whether diagnostic information is generated and included in the compiled [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] in order to aid debugging.
+ Gets or sets a value that indicates whether diagnostic information is generated and included in the compiled XAML in order to aid debugging.
- if diagnostic information is generated and included in the compiled [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] in order to aid debugging; otherwise, .
+ if diagnostic information is generated and included in the compiled XAML in order to aid debugging; otherwise, .
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass2.xml b/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass2.xml
index 145dea14a25..bcf539b7cae 100644
--- a/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass2.xml
+++ b/xml/Microsoft.Build.Tasks.Windows/MarkupCompilePass2.xml
@@ -195,8 +195,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
- The generated [!INCLUDE[TLA#tla_baml](~/includes/tlasharptla-baml-md.md)] files.
+ Gets or sets the generated binary XAML (BAML) files.
+ The generated binary XAML (BAML) files.
To be added.
@@ -288,8 +288,8 @@
System.String
- Gets or sets a value that specifies how to generate localization information for each [!INCLUDE[TLA#tla_xaml](~/includes/tlasharptla-xaml-md.md)] file.
- A value that specifies how to generate localization information for each [!INCLUDE[TLA#tla_xaml](~/includes/tlasharptla-xaml-md.md)] file. The valid values are **None**, **CommentsOnly**, and **All**.
+ Gets or sets a value that specifies how to generate localization information for each Extensible Application Markup Language (XAML) file.
+ A value that specifies how to generate localization information for each Extensible Application Markup Language (XAML) file. The valid values are **None**, **CommentsOnly**, and **All**.
To be added.
@@ -453,9 +453,9 @@
System.Boolean
- Gets or sets a value that indicates whether diagnostic information is generated and included in the compiled [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] in order to aid debugging.
+ Gets or sets a value that indicates whether diagnostic information is generated and included in the compiled XAML in order to aid debugging.
- if diagnostic information is generated and included in the compiled [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] in order to aid debugging; otherwise, .
+ if diagnostic information is generated and included in the compiled XAML in order to aid debugging; otherwise, .
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Windows/MergeLocalizationDirectives.xml b/xml/Microsoft.Build.Tasks.Windows/MergeLocalizationDirectives.xml
index 22b9412bbdd..b1254e265ab 100644
--- a/xml/Microsoft.Build.Tasks.Windows/MergeLocalizationDirectives.xml
+++ b/xml/Microsoft.Build.Tasks.Windows/MergeLocalizationDirectives.xml
@@ -95,8 +95,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the list of localization directives files for individual files in [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] binary format.
- The list of localization directives files for individual files in [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] binary format.
+ Gets or sets the list of localization directives files for individual files in XAML binary format.
+ The list of localization directives files for individual files in XAML binary format.
To be added.
diff --git a/xml/Microsoft.Build.Tasks.Windows/UidManager.xml b/xml/Microsoft.Build.Tasks.Windows/UidManager.xml
index 1d97a65b7a4..3df171a3918 100644
--- a/xml/Microsoft.Build.Tasks.Windows/UidManager.xml
+++ b/xml/Microsoft.Build.Tasks.Windows/UidManager.xml
@@ -87,8 +87,8 @@
System.String
- Gets or sets the directory that is used to back up the source [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that are specified by the property.
- The directory that is used to back up the source [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files that are specified by the property.
+ Gets or sets the directory that is used to back up the source XAML files that are specified by the property.
+ The directory that is used to back up the source XAML files that are specified by the property.
To be added.
@@ -124,8 +124,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the source [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files to include for UID checking, updating, or removing.
- The source [!INCLUDE[TLA2#tla_xaml](~/includes/tla2sharptla-xaml-md.md)] files to include for UID checking, updating, or removing.
+ Gets or sets the source XAML files to include for UID checking, updating, or removing.
+ The source XAML files to include for UID checking, updating, or removing.
To be added.
diff --git a/xml/Microsoft.Build.Tasks/CallTarget.xml b/xml/Microsoft.Build.Tasks/CallTarget.xml
index 18476382b45..3647c30a8f0 100644
--- a/xml/Microsoft.Build.Tasks/CallTarget.xml
+++ b/xml/Microsoft.Build.Tasks/CallTarget.xml
@@ -153,7 +153,7 @@
if one target fails, you can still continue with the remaining targets.
- if the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] engine is called once per target; if the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] engine is called once to build all targets.
+ if the MSBuild engine is called once per target; if the MSBuild engine is called once to build all targets.
To be added.
diff --git a/xml/Microsoft.Build.Tasks/CreateProperty.xml b/xml/Microsoft.Build.Tasks/CreateProperty.xml
index d6d796e6747..f62ff2b7f6a 100644
--- a/xml/Microsoft.Build.Tasks/CreateProperty.xml
+++ b/xml/Microsoft.Build.Tasks/CreateProperty.xml
@@ -227,7 +227,7 @@
diff --git a/xml/Microsoft.Build.Tasks/Csc.xml b/xml/Microsoft.Build.Tasks/Csc.xml
index c884aafb1b0..003300a187d 100644
--- a/xml/Microsoft.Build.Tasks/Csc.xml
+++ b/xml/Microsoft.Build.Tasks/Csc.xml
@@ -182,7 +182,7 @@
diff --git a/xml/Microsoft.Build.Tasks/GenerateApplicationManifest.xml b/xml/Microsoft.Build.Tasks/GenerateApplicationManifest.xml
index 4a71d99cf8a..9c9255c33b7 100644
--- a/xml/Microsoft.Build.Tasks/GenerateApplicationManifest.xml
+++ b/xml/Microsoft.Build.Tasks/GenerateApplicationManifest.xml
@@ -33,11 +33,11 @@
`[]` parameter that indicates the entry point for the generated manifest assembly. For a [!INCLUDE[ndptecclick](~/includes/ndptecclick-md.md)] deployment manifest, this input specifies the [!INCLUDE[ndptecclick](~/includes/ndptecclick-md.md)] application manifest.
+ `EntryPoint` is an optional `[]` parameter that indicates the entry point for the generated manifest assembly. For a ClickOnce deployment manifest, this input specifies the ClickOnce application manifest.
- In [!INCLUDE[vsprvslong](~/includes/vsprvslong-md.md)], the [GenerateApplicationManifest Task](/visualstudio/msbuild/generateapplicationmanifest-task) requires an `EntryPoint` when an application manifest is generated. (Assembly or native manifests do not require an `EntryPoint`.) This requirement is enforced by the build error "MSB3185: EntryPoint not specified for manifest."
+ In Visual Studio 2005, the [GenerateApplicationManifest Task](/visualstudio/msbuild/generateapplicationmanifest-task) requires an `EntryPoint` when an application manifest is generated. (Assembly or native manifests do not require an `EntryPoint`.) This requirement is enforced by the build error "MSB3185: EntryPoint not specified for manifest."
- In [!INCLUDE[vs_orcas_long](~/includes/vs-orcas-long-md.md)], [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] does not issue this error when the `EntryPoint` task parameter is not specified. Instead, the \ tag is inserted as a child of the \ tag, for example, as follows.
+ In Visual Studio 2008, MSBuild does not issue this error when the `EntryPoint` task parameter is not specified. Instead, the \ tag is inserted as a child of the \ tag, for example, as follows.
```xml
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets a list of one or more file type that are associated with the ClickOnce deployment manifest. File associations only valid only when [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 3.5 or later is targeted.
+ Gets or sets a list of one or more file type that are associated with the ClickOnce deployment manifest. File associations only valid only when .NET Framework 3.5 or later is targeted.
A list of file types that are associated with the generated manifest.
System.String
- Gets or sets the name of the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] subset to target.
- The name of the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] subset.
+ Gets or sets the name of the .NET Framework subset to target.
+ The name of the .NET Framework subset.
To be added.
diff --git a/xml/Microsoft.Build.Tasks/GenerateDeploymentManifest.xml b/xml/Microsoft.Build.Tasks/GenerateDeploymentManifest.xml
index dcdaf7a873d..83f68ef78c9 100644
--- a/xml/Microsoft.Build.Tasks/GenerateDeploymentManifest.xml
+++ b/xml/Microsoft.Build.Tasks/GenerateDeploymentManifest.xml
@@ -341,7 +341,7 @@
diff --git a/xml/Microsoft.Build.Tasks/GenerateManifestBase.xml b/xml/Microsoft.Build.Tasks/GenerateManifestBase.xml
index ba4528d62a5..33a8521c494 100644
--- a/xml/Microsoft.Build.Tasks/GenerateManifestBase.xml
+++ b/xml/Microsoft.Build.Tasks/GenerateManifestBase.xml
@@ -954,8 +954,8 @@
System.String
- The target [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] version for the project.
- A string that represents the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] version.
+ The target .NET Framework version for the project.
+ A string that represents the .NET Framework version.
Path to the v1.1 framework, if available
- The path of the folder that contains the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 1.1 assemblies.
+ The path of the folder that contains the .NET Framework 1.1 assemblies.
To be added.
@@ -186,7 +186,7 @@
Path to the v2.0 framework, if available
- The path of the folder that contains the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 2.0 assemblies.
+ The path of the folder that contains the .NET Framework 2.0 assemblies.
To be added.
@@ -224,7 +224,7 @@
Path to the v3.0 framework, if available
- The path of the folder that contains the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 3.0 assemblies.
+ The path of the folder that contains the .NET Framework 3.0 assemblies.
To be added.
@@ -262,7 +262,7 @@
Path to the v3.5 framework, if available
- The path of the folder that contains the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 3.5 assemblies.
+ The path of the folder that contains the .NET Framework 3.5 assemblies.
To be added.
@@ -637,7 +637,7 @@
Path to the latest framework, whatever version it happens to be
- The path of the folder that contains the latest version of the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] assemblies.
+ The path of the folder that contains the latest version of the .NET Framework assemblies.
To be added.
diff --git a/xml/Microsoft.Build.Tasks/GetFrameworkSdkPath.xml b/xml/Microsoft.Build.Tasks/GetFrameworkSdkPath.xml
index f29ab94ec5e..ff8f0819858 100644
--- a/xml/Microsoft.Build.Tasks/GetFrameworkSdkPath.xml
+++ b/xml/Microsoft.Build.Tasks/GetFrameworkSdkPath.xml
@@ -146,7 +146,7 @@
The path to the v2.0 .NET SDK if it could be found. It will be String.Empty if the SDK was not found.
- The path to the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 2.0 SDK.
+ The path to the .NET Framework 2.0 SDK.
To be added.
@@ -184,7 +184,7 @@
The path to the v3.5 .NET SDK if it could be found. It will be String.Empty if the SDK was not found.
- The path to the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] 3.5 SDK.
+ The path to the .NET Framework 3.5 SDK.
To be added.
@@ -381,7 +381,7 @@
The path to the latest .NET SDK if it could be found. It will be String.Empty if the SDK was not found.
- The path to the latest version of the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] SDK.
+ The path to the latest version of the .NET Framework SDK.
To be added.
diff --git a/xml/Microsoft.Build.Tasks/MSBuild.xml b/xml/Microsoft.Build.Tasks/MSBuild.xml
index a0f4dfae6dd..3a73bf82c98 100644
--- a/xml/Microsoft.Build.Tasks/MSBuild.xml
+++ b/xml/Microsoft.Build.Tasks/MSBuild.xml
@@ -399,7 +399,7 @@
if one target fails, you can still continue with the remaining targets.
- if the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] task invokes each target in the list passed to [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] one at a time; if the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] task invokes all targets in the list at the same time.
+ if the MSBuild task invokes each target in the list passed to MSBuild one at a time; if the MSBuild task invokes all targets in the list at the same time.
Value of ToolsVersion to use when building projects passed to this task.
- The target [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] version to build the project with.
+ The target .NET Framework version to build the project with.
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resource files to link to the output file.
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resource files to link to the output file.
+ Gets or sets the .NET Framework resource files to link to the output file.
+ The .NET Framework resource files to link to the output file.
To be added.
This class uses the attribute and cannot be inherited.
@@ -1032,8 +1032,8 @@
Microsoft.Build.Framework.ITaskItem[]
- Gets or sets the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed in the output file.
- The [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] resources to embed in the output file.
+ Gets or sets the .NET Framework resources to embed in the output file.
+ The .NET Framework resources to embed in the output file.
To be added.
This class uses the attribute and cannot be inherited.
diff --git a/xml/Microsoft.Build.Tasks/ResolveNonMSBuildProjectOutput.xml b/xml/Microsoft.Build.Tasks/ResolveNonMSBuildProjectOutput.xml
index 2b5042dbf5d..e24217337f0 100644
--- a/xml/Microsoft.Build.Tasks/ResolveNonMSBuildProjectOutput.xml
+++ b/xml/Microsoft.Build.Tasks/ResolveNonMSBuildProjectOutput.xml
@@ -258,7 +258,7 @@
Since VS only pre-resolves non-MSBuild projects, this means that project references in this list
are in the MSBuild format.
- Project reference items that are in the [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] format.
+ Project reference items that are in the MSBuild format.
diff --git a/xml/Microsoft.Build.Tasks/Vbc.xml b/xml/Microsoft.Build.Tasks/Vbc.xml
index 5162851eefa..c51d940f0d4 100644
--- a/xml/Microsoft.Build.Tasks/Vbc.xml
+++ b/xml/Microsoft.Build.Tasks/Vbc.xml
@@ -951,9 +951,9 @@ This property can have a value of **x86**, **x64**, **Itanium**, or **anycpu**.
System.Boolean
- Gets or sets a Boolean value that specifies whether to target the [!INCLUDE[Compact](~/includes/compact-md.md)].
+ Gets or sets a Boolean value that specifies whether to target the .NET Compact Framework.
- if the Vbc task should target the [!INCLUDE[Compact](~/includes/compact-md.md)]; otherwise, .
+ if the Vbc task should target the .NET Compact Framework; otherwise, .
To be added.
diff --git a/xml/Microsoft.Build.Tasks/Warning.xml b/xml/Microsoft.Build.Tasks/Warning.xml
index 17a516f7e26..f723a74214b 100644
--- a/xml/Microsoft.Build.Tasks/Warning.xml
+++ b/xml/Microsoft.Build.Tasks/Warning.xml
@@ -280,7 +280,7 @@
Error message
- The warning text that [!INCLUDE[vstecmsbuild](~/includes/vstecmsbuild-md.md)] logs.
+ The warning text that MSBuild logs.
To be added.
diff --git a/xml/Microsoft.Build.Utilities/ToolLocationHelper.xml b/xml/Microsoft.Build.Utilities/ToolLocationHelper.xml
index bc935871ce4..6b554105f44 100644
--- a/xml/Microsoft.Build.Utilities/ToolLocationHelper.xml
+++ b/xml/Microsoft.Build.Utilities/ToolLocationHelper.xml
@@ -419,7 +419,7 @@
to target the .NET Framework SDK that ships with Visual Studio Dev11 or later, please use the override
that specifies a VisualStudioVersion.
- A string containing the name of the registry key value under the that contains the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] SDK installation path.
+ A string containing the name of the registry key value under the that contains the .NET Framework SDK installation path.
To be added.
diff --git a/xml/Microsoft.VisualBasic.ApplicationServices/WindowsFormsApplicationBase.xml b/xml/Microsoft.VisualBasic.ApplicationServices/WindowsFormsApplicationBase.xml
index fac8e3b7687..38b8d8096e9 100644
--- a/xml/Microsoft.VisualBasic.ApplicationServices/WindowsFormsApplicationBase.xml
+++ b/xml/Microsoft.VisualBasic.ApplicationServices/WindowsFormsApplicationBase.xml
@@ -1673,12 +1673,12 @@
When overridden in a derived class, this property allows a designer to specify the default text rendering engine for the application's forms.
- . A value of indicates that the application should use the default text rendering engine for [!INCLUDE[vbprvblong](~/includes/vbprvblong-md.md)]. A value of indicates that the application should use the text rendering engine for Visual Basic .NET 2002 and Visual Basic .NET 2003.
+ . A value of indicates that the application should use the default text rendering engine for Visual Basic 2005. A value of indicates that the application should use the text rendering engine for Visual Basic .NET 2002 and Visual Basic .NET 2003.
constructor.
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+BOFActionEnum.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+BOFActionEnum.xml
index cf9a3a2eda3..d4dce686491 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+BOFActionEnum.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+BOFActionEnum.xml
@@ -31,7 +31,7 @@
These constants enable code that has been upgraded from Visual Basic 6.0 to continue to run without additional modification.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+EOFActionEnum.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+EOFActionEnum.xml
index c50e68a7347..8d347443f4d 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+EOFActionEnum.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+EOFActionEnum.xml
@@ -31,7 +31,7 @@
These constants enable code that has been upgraded from Visual Basic 6.0 to continue to run without additional modification.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+ErrorDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+ErrorDelegate.xml
index 01311a0eb21..60c66b8c489 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+ErrorDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+ErrorDelegate.xml
@@ -47,7 +47,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FetchCompleteDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FetchCompleteDelegate.xml
index f891f6e82f2..35302cc6b3e 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FetchCompleteDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FetchCompleteDelegate.xml
@@ -43,7 +43,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FieldChangeCompleteDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FieldChangeCompleteDelegate.xml
index f08e1bd3599..df7bb53a61a 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FieldChangeCompleteDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+FieldChangeCompleteDelegate.xml
@@ -47,7 +47,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+OrientationEnum.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+OrientationEnum.xml
index b26adfd6c83..75e4e41e9b8 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+OrientationEnum.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+OrientationEnum.xml
@@ -29,7 +29,7 @@
In Visual Basic 6.0, the `Orientation` property was used to specify whether a `ADODataControl` was displayed with a horizontal or vertical orientation.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+RecordsetChangeCompleteDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+RecordsetChangeCompleteDelegate.xml
index e7b40e07e89..30b0c63cffb 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+RecordsetChangeCompleteDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+RecordsetChangeCompleteDelegate.xml
@@ -45,7 +45,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeFieldDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeFieldDelegate.xml
index a0c4991b597..11f754cfa13 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeFieldDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeFieldDelegate.xml
@@ -45,7 +45,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordDelegate.xml
index 852eca276de..c15b3ebc85c 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordDelegate.xml
@@ -45,7 +45,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordsetDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordsetDelegate.xml
index c7b0d1c54a6..a9c8f3d33e4 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordsetDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillChangeRecordsetDelegate.xml
@@ -43,7 +43,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillMoveDelegate.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillMoveDelegate.xml
index 08a2d1b410a..ac2346c4037 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillMoveDelegate.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC+WillMoveDelegate.xml
@@ -43,7 +43,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC.xml
index ee1eb5f411c..1eee66ea1dd 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODC.xml
@@ -34,7 +34,7 @@
Use this control in applications upgraded from Visual Basic 6.0 to continue to use an `ADO` data connection. For new development, you should consider using `ADO.NET` instead of `ADO`. For more information, see [Comparison of ADO.NET and ADO](https://docs.microsoft.com/previous-versions/visualstudio/visual-studio-2008/904fck4k(v=vs.90)).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -63,7 +63,7 @@
Provides compatibility with the Visual Basic 6.0 `ADO Data Control`.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -108,7 +108,7 @@
The `DataSourceListener` monitors a data set for data members that are added, removed, or changed when the is connected to a data source.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -154,7 +154,7 @@
Setting the `BackColor` property affects only the part of the control where text is displayed.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -200,7 +200,7 @@
You can use the `BOF` and properties to determine whether an object contains rows or whether you have gone beyond the limits of an as you move from row to row.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -247,7 +247,7 @@
Use this property to specify the behavior when the `MovePrevious` button is pressed and the first row of a is the current row.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -296,7 +296,7 @@
While you can change value during the life of the cursor, the change only affects the number of records in the cache after the next fetch from the data source.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -343,7 +343,7 @@
After this period of time has elapsed without completing the command, the provider raises an exception to the calling application and cancels the command.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -394,7 +394,7 @@
Setting this property optimizes the execution of the command.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -441,7 +441,7 @@
Use the `ConnectionString` property to specify a data source by passing a detailed connection string that contains a series of argument = value statements separated by semicolons.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -488,7 +488,7 @@
This property corresponds to the ADO `ConnectionTimeout` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -539,7 +539,7 @@
This property corresponds to the ADO Command and Connection `CursorLocation` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -590,7 +590,7 @@
Determines the cursor type to use when opening a .
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -633,7 +633,7 @@
When the disposing parameter is `true`, this method releases all resources held by any managed objects that this control references. This method invokes the `Dispose()` method of each referenced object.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -676,7 +676,7 @@
An `EndOfRecordset` event may occur if the `MoveNext` operation fails.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -722,7 +722,7 @@
You can use the and `EOF` properties to determine whether an object contains rows or whether you have gone beyond the limits of an as you move from row to row.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -769,7 +769,7 @@
Use this property to specify the behavior when the `MoveNext` button is pressed when the first row of a is the current row.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -802,7 +802,7 @@
Use this event to handle exceptions that derive from the underlying OLE DB `DataSource`.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -841,7 +841,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -880,7 +880,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -919,7 +919,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -960,7 +960,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -997,7 +997,7 @@
Used internally to return a count of data members for the .
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1037,7 +1037,7 @@
Used internally to return the name of a data member for a .
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1088,7 +1088,7 @@
In order to maintain sufficient control over the data being updated, `ADO` provides a number of concurrency options that control how other users are granted, or refused access to the data being updated.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1135,7 +1135,7 @@
This property corresponds to the ADO `Recordset.MaxRecords` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1186,7 +1186,7 @@
This property corresponds to the ADO `Mode` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1225,7 +1225,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1264,7 +1264,7 @@
The `OnResize` method also enables derived classes to handle the event without attaching a delegate. This is the preferred technique for handling the event in a derived class.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1318,7 +1318,7 @@
This property corresponds to the ADO `Recordset.MaxRecords` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1361,7 +1361,7 @@
This property setting is write-only. It may only be provided in code, it cannot be read back from the `Password` property.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1400,7 +1400,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1447,7 +1447,7 @@
By using the `Recordset` property, you can use the methods, properties, and events of the ADO `ADODB.Recordset` Object.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1486,7 +1486,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1533,7 +1533,7 @@
The `RecordSource` contains both the name of a database table and a valid SQL string using syntax appropriate for the data source.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1570,7 +1570,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1615,7 +1615,7 @@
The `DataSourceListener` monitors a data set for data members that are added, removed, or changed when the is connected to a data source.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1670,7 +1670,7 @@
Use this property to communicate information such as the number of the current record to the user.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1717,7 +1717,7 @@
The user-name syntax depends on the data source. When a `UserName` and are supplied, the control uses the values to create a connection string ( property).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1755,7 +1755,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1793,7 +1793,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1831,7 +1831,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1869,7 +1869,7 @@
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
diff --git a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODCArray.xml b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODCArray.xml
index d74ebcb338e..6db7913d9bf 100644
--- a/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODCArray.xml
+++ b/xml/Microsoft.VisualBasic.Compatibility.VB6/ADODCArray.xml
@@ -42,7 +42,7 @@
The `ADODCArray` class provides an equivalent for the run-time functionality of a Visual Basic 6.0 `ADODC` control array. It does not provide the design-time features of a Visual Basic 6.0 control array.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -86,7 +86,7 @@
When you instantiate an , you must also call the method to create the initial element in the array.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -125,7 +125,7 @@
When you instantiate an , you must also call the method to create the initial element in the array.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -160,7 +160,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -195,7 +195,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -230,7 +230,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -277,7 +277,7 @@
The `CanExtend` method can be used to determine whether a specific control is the base element of the control array from which the other elements were cloned.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -312,7 +312,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -345,7 +345,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -382,7 +382,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -417,7 +417,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -450,7 +450,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -485,7 +485,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -520,7 +520,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -553,7 +553,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -586,7 +586,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -622,7 +622,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -658,7 +658,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -694,7 +694,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -730,7 +730,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -771,7 +771,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -824,7 +824,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -857,7 +857,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -896,7 +896,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -935,7 +935,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -974,7 +974,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1009,7 +1009,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1044,7 +1044,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1079,7 +1079,7 @@
This method cannot be called from your application's code. Use the method instead.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1116,7 +1116,7 @@
This method can be used to retrieve the index for the specified
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1151,7 +1151,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1187,7 +1187,7 @@
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1225,7 +1225,7 @@
This method cannot be called from your application's code. Use `AddHandler` to hook up events for any controls that are added by using the method.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1258,7 +1258,7 @@
This event is raised if the property is changed by either a programmatic modification or user interaction. For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1301,7 +1301,7 @@ MsgBox(CStr(ADODCArray(1).Text))
```
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1344,7 +1344,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1392,7 +1392,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1436,7 +1436,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1472,7 +1472,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1526,7 +1526,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1562,7 +1562,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1611,7 +1611,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1657,7 +1657,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1709,7 +1709,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1755,7 +1755,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1801,7 +1801,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1847,7 +1847,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1881,7 +1881,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1921,7 +1921,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1956,7 +1956,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -1992,7 +1992,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2027,7 +2027,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2061,7 +2061,7 @@ MsgBox(CStr(ADODCArray(1).Text))
The `QueryContinueDrag` event is raised when there is a change in the keyboard or mouse button state during a drag-and-drop operation. The `QueryContinueDrag` event enables the drag source to determine whether the drag-and-drop operation should be canceled.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2101,7 +2101,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2140,7 +2140,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2182,7 +2182,7 @@ MsgBox(CStr(ADODCArray(1).Text))
This method is not supported, and calling it does not raise an exception.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2219,7 +2219,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2255,7 +2255,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2299,7 +2299,7 @@ MsgBox(CStr(ADODCArray(1).Text))
The `SetIndex` method should be called only when you are creating the initial element in the control array. To add subsequent elements, call the method and specify the `Index`.
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2341,7 +2341,7 @@ MsgBox(CStr(ADODCArray(1).Text))
## Remarks
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2376,7 +2376,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2413,7 +2413,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2448,7 +2448,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2484,7 +2484,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the .NET Framework. They are necessary only when the Visual Basic 6.0 code model differs significantly from the .NET Framework implementation.
]]>
@@ -2519,7 +2519,7 @@ MsgBox(CStr(ADODCArray(1).Text))
For more information about how to handle events, see [Handling and Raising Events](/dotnet/standard/events/).
> [!NOTE]
-> Functions and objects in the namespace are provided for use by the tools for upgrading from Visual Basic 6.0 to Visual Basic. In most cases, these functions and objects duplicate functionality that you can find in other namespaces in the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)]. They are necessary only when the Visual Basic 6.0 code model differs significantly from the [!INCLUDE[dnprdnshort](~/includes/dnprdnshort-md.md)] implementation.
+> Functions and objects in the